PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn314511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 165aa    MW: 18098.9 Da    PI: 8.1167
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn314511genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.82.1e-4461051100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp ++p+kf +vhk+FGasnv+k+l++lp ++r da+sslvyeA ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  Achn314511   6 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFSIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEATARMRDPVYGCVGAISYLQNQVSQLQMQLAVAQA 104
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn314511 105 E 105
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7485106IPR004883Lateral organ boundaries, LOB
PfamPF031958.5E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPPD DPHKFSIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA TARMRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPTLPTN  120
QIDPVDKKSL LLSATNVNNI PQYLGFASSS SVIQDPLKRE SLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257046.11e-101PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-82LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9GH621e-100B9GH62_POPTR; LOB domain protein 12
STRINGPOPTR_0001s28840.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-83LBD family protein